Lineage for d1x8uc1 (1x8u C:5-177)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673763Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 673764Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries)
  8. 673773Domain d1x8uc1: 1x8u C:5-177 [121809]
    automatically matched to d1l6ma_
    complexed with cm2; mutant

Details for d1x8uc1

PDB Entry: 1x8u (more details), 2.2 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with carboxymycobactin t
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOP Domain Sequences for d1x8uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8uc1 b.60.1.1 (C:5-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOP Domain Coordinates for d1x8uc1:

Click to download the PDB-style file with coordinates for d1x8uc1.
(The format of our PDB-style files is described here.)

Timeline for d1x8uc1: