SCOPe 2.07: Domain d1x8ub_: 1x8u B:

Lineage for d1x8ub_ (1x8u B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d1x8ub_: 1x8u B: [121808]
   automated match to d1ngla_
   complexed with cm2

Details for d1x8ub_

PDB Entry: 1x8u, 2.2 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with carboxymycobactin t

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d1x8ub_:

Sequence, based on SEQRES records:

>d1x8ub_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksyn
vtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkk
vsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records):

>d1x8ub_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
dlipapplskvplqqnfqdnqfqgkwyvvglagnailrepqkmyatiyelkedksynvts
vlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvsq
nreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1x8ub_:

• d1x8ub_ first appeared in SCOP 1.73, called d1x8ub1
  
• d1x8ub_ appears in SCOPe 2.06
  
• d1x8ub_ appears in the current release, SCOPe 2.08