![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
![]() | Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries) |
![]() | Domain d1x8ub_: 1x8u B: [121808] automated match to d1ngla_ complexed with cm2 |
PDB Entry: 1x8u (more details), 2.2 Å
SCOPe Domain Sequences for d1x8ub_:
Sequence, based on SEQRES records: (download)
>d1x8ub_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} dlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksyn vtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkk vsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
>d1x8ub_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} dlipapplskvplqqnfqdnqfqgkwyvvglagnailrepqkmyatiyelkedksynvts vlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvsq nreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
Timeline for d1x8ub_: