Lineage for d1x8ra1 (1x8r A:1-427)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726532Fold d.68: IF3-like [55199] (7 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 726542Superfamily d.68.2: EPT/RTPC-like [55205] (2 families) (S)
  5. 726552Family d.68.2.2: Enolpyruvate transferase, EPT [55209] (2 proteins)
    duplication: 6 repeats of this fold are organized in two RPTC-like domains
  6. 726553Protein 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase [55213] (2 species)
  7. 726554Species Escherichia coli [TaxId:562] [55214] (11 PDB entries)
  8. 726557Domain d1x8ra1: 1x8r A:1-427 [121805]
    automatically matched to d1g6sa_
    complexed with fmt, sc1

Details for d1x8ra1

PDB Entry: 1x8r (more details), 1.5 Å

PDB Description: epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate
PDB Compounds: (A:) 3-phosphoshikimate 1-carboxyvinyltransferase

SCOP Domain Sequences for d1x8ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x8ra1 d.68.2.2 (A:1-427) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]}
mesltlqpiarvdgtinlpgsksvsnralllaalahgktvltnlldsddvrhmlnaltal
gvsytlsadrtrceiignggplhaegalelflgnagtamrplaaalclgsndivltgepr
mkerpighlvdalrlggakityleqenypplrlqggftggnvdvdgsvssqfltallmta
plapedtvirikgdlvskpyiditlnlmktfgveienqhyqqfvvkggqsyqspgtylve
gdassasyflaaaaikggtvkvtgigrnsmqgdirfadvlekmgaticwgddyisctrge
lnaidmdmnhipdaamtiataalfakgtttlrniynwrvketdrlfamatelrkvgaeve
eghdyiritppeklnfaeiatyndhrmamcfslvalsdtpvtildpkctaktfpdyfeql
arisqaa

SCOP Domain Coordinates for d1x8ra1:

Click to download the PDB-style file with coordinates for d1x8ra1.
(The format of our PDB-style files is described here.)

Timeline for d1x8ra1: