SCOPe 2.08: Domain d1x8ca_: 1x8c A:

Lineage for d1x8ca_ (1x8c A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.30: CutC-like [110395] (2 families)
   automatically mapped to Pfam PF03932

5. Family c.1.30.1: CutC-like [110396] (2 proteins)
   Pfam PF03932

6. Protein automated matches [190128] (1 species)
   not a true protein

7. Species Shigella flexneri [TaxId:198214] [186852] (2 PDB entries)

8. Domain d1x8ca_: 1x8c A: [121802]
   Other proteins in same PDB: d1x8cb3
   automated match to d1twdb_
   complexed with ca

Details for d1x8ca_

PDB Entry: 1x8c, 2.1 Å

PDB Description: crystal structure of the semet-derivative copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301

PDB Compounds: (A:) Copper homeostasis protein cutC

SCOPe Domain Sequences for d1x8ca_:

Sequence, based on SEQRES records:

>d1x8ca_ c.1.30.1 (A:) automated matches {Shigella flexneri [TaxId: 198214]}
malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
iierhqak

Sequence, based on observed residues (ATOM records):

>d1x8ca_ c.1.30.1 (A:) automated matches {Shigella flexneri [TaxId: 198214]}
malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
aenlhhfldagvlevhssagawqaspmryrysryivdgaavaemkgiierhqak

Timeline for d1x8ca_:

• d1x8ca_ first appeared in SCOP 1.73, called d1x8ca1
  
• d1x8ca_ appears in SCOPe 2.07