SCOPe 2.08: Domain d1x89b_: 1x89 B:

Lineage for d1x89b_ (1x89 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (49 PDB entries)

8. Domain d1x89b_: 1x89 B: [121800]
   automated match to d1ngla_
   complexed with cm1

Details for d1x89b_

PDB Entry: 1x89, 2.1 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with carboxymycobactin s

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d1x89b_:

Sequence, based on SEQRES records:

>d1x89b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records):

>d1x89b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailrepqkmyatiyelkedksynv
tsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkv
sqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1x89b_:

• d1x89b_ first appeared in SCOP 1.73, called d1x89b1
  
• d1x89b_ appears in SCOPe 2.07