SCOPe 2.06: Domain d1x83a1: 1x83 A:4-179

Lineage for d1x83a1 (1x83 A:4-179)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (2 species)

7. Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
   Uniprot Q46822

8. Domain d1x83a1: 1x83 A:4-179 [121793]
   Other proteins in same PDB: d1x83b3
   complexed with mg, mn, sbh

Details for d1x83a1

PDB Entry: 1x83, 1.8 Å

PDB Description: y104f ipp isomerase reacted with (s)-bromohydrine of ipp

PDB Compounds: (A:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d1x83a1:

Sequence; same for both SEQRES and ATOM records:

>d1x83a1 d.113.1.2 (A:4-179) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfrfratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d1x83a1:

• d1x83a1 first appeared in SCOP 1.73
  
• d1x83a1 appears in SCOPe 2.05
  
• d1x83a1 appears in SCOPe 2.07
  
• d1x83a1 appears in the current release, SCOPe 2.08