Lineage for d1x7jb_ (1x7j B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008714Protein Estrogen receptor beta [48521] (2 species)
  7. 2008715Species Human (Homo sapiens) [TaxId:9606] [48522] (26 PDB entries)
  8. 2008735Domain d1x7jb_: 1x7j B: [121789]
    automated match to d1l2ja_
    complexed with gen

Details for d1x7jb_

PDB Entry: 1x7j (more details), 2.3 Å

PDB Description: crystal structure of estrogen receptor beta complexed with genistein
PDB Compounds: (B:) Estrogen receptor beta

SCOPe Domain Sequences for d1x7jb_:

Sequence, based on SEQRES records: (download)

>d1x7jb_ a.123.1.1 (B:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
ttsrfrelklqhkeylcvkamillnssmyplvtatqdadssrklahllnavtdalvwvia
ksgissqqqsmrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna

Sequence, based on observed residues (ATOM records): (download)

>d1x7jb_ a.123.1.1 (B:) Estrogen receptor beta {Human (Homo sapiens) [TaxId: 9606]}
lspeqlvltlleaepphvlisrpsapfteasmmmsltkladkelvhmiswakkipgfvel
slfdqvrllescwmevlmmglmwrsidhpgklifapdlvldrdegkcvegileifdmlla
ttsrfrelklqhkeylcvkamillnssmdssrklahllnavtdalvwviaksgissqqqs
mrlanllmllshvrhasnkgmehllnmkcknvvpvydlllemlna

SCOPe Domain Coordinates for d1x7jb_:

Click to download the PDB-style file with coordinates for d1x7jb_.
(The format of our PDB-style files is described here.)

Timeline for d1x7jb_: