SCOP 1.75: Domain d1x7ib1: 1x7i B:2-248

Lineage for d1x7ib1 (1x7i B:2-248)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.30: CutC-like [110395] (1 family)

5. Family c.1.30.1: CutC-like [110396] (1 protein)
   Pfam PF03932

6. Protein Copper homeostasis protein CutC [110397] (1 species)

7. Species Shigella flexneri [TaxId:623] [110398] (3 PDB entries)
   Uniprot P67825

8. Domain d1x7ib1: 1x7i B:2-248 [121787]
   automatically matched to d1twdb_
   complexed with ca

Details for d1x7ib1

PDB Entry: 1x7i, 1.7 Å

PDB Description: crystal structure of the native copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301

PDB Compounds: (B:) Copper homeostasis protein cutC

SCOP Domain Sequences for d1x7ib1:

Sequence, based on SEQRES records:

>d1x7ib1 c.1.30.1 (B:2-248) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkgi
ierhqak

Sequence, based on observed residues (ATOM records):

>d1x7ib1 c.1.30.1 (B:2-248) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrneysryivdgaavaemkgiierhqak

Timeline for d1x7ib1:

• d1x7ib1 first appeared in SCOP 1.73
  
• d1x7ib1 is called d1x7ib_ in SCOPe 2.01
  
• d1x7ib1 appears in the current release, SCOPe 2.08, called d1x7ib2