Lineage for d1x7ib1 (1x7i B:2-248)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685938Superfamily c.1.30: CutC-like [110395] (1 family) (S)
  5. 685939Family c.1.30.1: CutC-like [110396] (1 protein)
    Pfam PF03932
  6. 685940Protein Copper homeostasis protein CutC [110397] (1 species)
  7. 685941Species Shigella flexneri [TaxId:623] [110398] (3 PDB entries)
  8. 685945Domain d1x7ib1: 1x7i B:2-248 [121787]
    automatically matched to d1twdb_
    complexed with ca

Details for d1x7ib1

PDB Entry: 1x7i (more details), 1.7 Å

PDB Description: crystal structure of the native copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301
PDB Compounds: (B:) Copper homeostasis protein cutC

SCOP Domain Sequences for d1x7ib1:

Sequence, based on SEQRES records: (download)

>d1x7ib1 c.1.30.1 (B:2-248) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkgi
ierhqak

Sequence, based on observed residues (ATOM records): (download)

>d1x7ib1 c.1.30.1 (B:2-248) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}
alleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirpr
ggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtfh
rafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvra
enlhhfldagvlevhssagawqaspmryrneysryivdgaavaemkgiierhqak

SCOP Domain Coordinates for d1x7ib1:

Click to download the PDB-style file with coordinates for d1x7ib1.
(The format of our PDB-style files is described here.)

Timeline for d1x7ib1:

Domains from other chains:
(mouse over for more information)
d1x7ia1