Lineage for d1x7ia_ (1x7i A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2449297Superfamily c.1.30: CutC-like [110395] (2 families) (S)
    automatically mapped to Pfam PF03932
  5. 2449298Family c.1.30.1: CutC-like [110396] (2 proteins)
    Pfam PF03932
  6. 2449303Protein automated matches [190128] (1 species)
    not a true protein
  7. 2449304Species Shigella flexneri [TaxId:198214] [186852] (2 PDB entries)
  8. 2449305Domain d1x7ia_: 1x7i A: [121786]
    Other proteins in same PDB: d1x7ib3
    automated match to d1twdb_
    complexed with ca

Details for d1x7ia_

PDB Entry: 1x7i (more details), 1.7 Å

PDB Description: crystal structure of the native copper homeostasis protein (cutcm) with calcium binding from shigella flexneri 2a str. 301
PDB Compounds: (A:) Copper homeostasis protein cutC

SCOPe Domain Sequences for d1x7ia_:

Sequence, based on SEQRES records: (download)

>d1x7ia_ c.1.30.1 (A:) automated matches {Shigella flexneri [TaxId: 198214]}
malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
aenlhhfldagvlevhssagawqaspmryrnqglsmssdehadeysryivdgaavaemkg
iierhqak

Sequence, based on observed residues (ATOM records): (download)

>d1x7ia_ c.1.30.1 (A:) automated matches {Shigella flexneri [TaxId: 198214]}
malleiccysmecaltaqqngadrvelcaapkeggltpslgvlksvrqrvtipvhpiirp
rggdfcysdgefaailedvrtvrelgfpglvtgvldvdgnvdmprmekimaaagplavtf
hrafdmcanplytlnnlaelgiarvltsgqksdalqglskimeliahrdapiimagagvr
aenlhhfldagvlevhssagawqaspmryrdeysryivdgaavaemkgiierhqak

SCOPe Domain Coordinates for d1x7ia_:

Click to download the PDB-style file with coordinates for d1x7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1x7ia_: