Lineage for d1x7al2 (1x7a L:87-146)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258095Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 2258282Protein Factor IX (IXa) [57198] (2 species)
  7. 2258303Species Pig (Sus scrofa) [TaxId:9823] [57200] (2 PDB entries)
  8. 2258307Domain d1x7al2: 1x7a L:87-146 [121783]
    Other proteins in same PDB: d1x7ac_
    automated match to d1pfxl2
    complexed with 187

Details for d1x7al2

PDB Entry: 1x7a (more details), 2.9 Å

PDB Description: Porcine Factor IXa Complexed to 1-{3-[amino(imino)methyl]phenyl}-N-[4-(1H-benzimidazol-1-yl)-2-fluorophenyl]-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide
PDB Compounds: (L:) Coagulation Factor IX, light chain

SCOPe Domain Sequences for d1x7al2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x7al2 g.3.11.1 (L:87-146) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
tcnikngrckqfcktgadskvlcscttgyrlapdqksckpavpfpcgrvsvshspttltr

SCOPe Domain Coordinates for d1x7al2:

Click to download the PDB-style file with coordinates for d1x7al2.
(The format of our PDB-style files is described here.)

Timeline for d1x7al2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x7al1
View in 3D
Domains from other chains:
(mouse over for more information)
d1x7ac_