Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Factor IX (IXa) [57198] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [57200] (2 PDB entries) |
Domain d1x7al2: 1x7a L:87-146 [121783] Other proteins in same PDB: d1x7ac_ automated match to d1pfxl2 complexed with 187 |
PDB Entry: 1x7a (more details), 2.9 Å
SCOPe Domain Sequences for d1x7al2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x7al2 g.3.11.1 (L:87-146) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} tcnikngrckqfcktgadskvlcscttgyrlapdqksckpavpfpcgrvsvshspttltr
Timeline for d1x7al2: