Lineage for d1x75d_ (1x75 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393878Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2393879Family b.34.6.1: CcdB [50119] (1 protein)
    automatically mapped to Pfam PF01845
  6. 2393880Protein CcdB [50120] (2 species)
    topoisomerase poison
  7. 2393881Species Escherichia coli [TaxId:562] [50121] (7 PDB entries)
  8. 2393901Domain d1x75d_: 1x75 D: [121776]
    Other proteins in same PDB: d1x75a1, d1x75b_
    automated match to d1vuba_

Details for d1x75d_

PDB Entry: 1x75 (more details), 2.8 Å

PDB Description: CcdB:GyrA14 complex
PDB Compounds: (D:) Cytotoxic protein ccdB

SCOPe Domain Sequences for d1x75d_:

Sequence, based on SEQRES records: (download)

>d1x75d_ b.34.6.1 (D:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Sequence, based on observed residues (ATOM records): (download)

>d1x75d_ b.34.6.1 (D:) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykrerlfvdvqsdiidtpgrrmviplasarllssrelypvvhigdeswrmmtt
dmasvpvsvigeevadlshrendiknainlmfwgi

SCOPe Domain Coordinates for d1x75d_:

Click to download the PDB-style file with coordinates for d1x75d_.
(The format of our PDB-style files is described here.)

Timeline for d1x75d_: