SCOP 1.73: Domain d1x75d1: 1x75 D:1-101

Lineage for d1x75d1 (1x75 D:1-101)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.1: CcdB [50119] (1 protein)

6. Protein CcdB [50120] (1 species)
   topoisomerase poison

7. Species Escherichia coli [TaxId:562] [50121] (5 PDB entries)

8. Domain d1x75d1: 1x75 D:1-101 [121776]
   automatically matched to d1vuba_

Details for d1x75d1

PDB Entry: 1x75, 2.8 Å

PDB Description: CcdB:GyrA14 complex

PDB Compounds: (D:) Cytotoxic protein ccdB

SCOP Domain Sequences for d1x75d1:

Sequence, based on SEQRES records:

>d1x75d1 b.34.6.1 (D:1-101) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes
wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi

Sequence, based on observed residues (ATOM records):

>d1x75d1 b.34.6.1 (D:1-101) CcdB {Escherichia coli [TaxId: 562]}
mqfkvytykrerlfvdvqsdiidtpgrrmviplasarllssrelypvvhigdeswrmmtt
dmasvpvsvigeevadlshrendiknainlmfwgi

Timeline for d1x75d1:

• d1x75d1 is new in SCOP 1.73
  
• d1x75d1 appears in SCOP 1.75
  
• d1x75d1 appears in the current release, SCOPe 2.08, called d1x75d_