Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families) contains insert beta-sheet subdomain and C-terminal helix |
Family b.34.6.1: CcdB [50119] (1 protein) |
Protein CcdB [50120] (1 species) topoisomerase poison |
Species Escherichia coli [TaxId:562] [50121] (5 PDB entries) |
Domain d1x75d1: 1x75 D:1-101 [121776] automatically matched to d1vuba_ |
PDB Entry: 1x75 (more details), 2.8 Å
SCOP Domain Sequences for d1x75d1:
Sequence, based on SEQRES records: (download)
>d1x75d1 b.34.6.1 (D:1-101) CcdB {Escherichia coli [TaxId: 562]} mqfkvytykresryrlfvdvqsdiidtpgrrmviplasarllsdkvsrelypvvhigdes wrmmttdmasvpvsvigeevadlshrendiknainlmfwgi
>d1x75d1 b.34.6.1 (D:1-101) CcdB {Escherichia coli [TaxId: 562]} mqfkvytykrerlfvdvqsdiidtpgrrmviplasarllssrelypvvhigdeswrmmtt dmasvpvsvigeevadlshrendiknainlmfwgi
Timeline for d1x75d1: