Lineage for d1x71c1 (1x71 C:4-177)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805867Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 805868Superfamily b.60.1: Lipocalins [50814] (9 families) (S)
    bind hydrophobic ligands in their interior
  5. 805869Family b.60.1.1: Retinol binding protein-like [50815] (21 proteins)
    barrel, closed; n=8, S=12, meander
  6. 805996Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 805997Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries)
  8. 806000Domain d1x71c1: 1x71 C:4-177 [121770]
    automatically matched to d1l6ma_
    complexed with db1, fe; mutant

Details for d1x71c1

PDB Entry: 1x71 (more details), 2.1 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with trencam-3,2-hopo, a cepabactin analogue
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOP Domain Sequences for d1x71c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x71c1 b.60.1.1 (C:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOP Domain Coordinates for d1x71c1:

Click to download the PDB-style file with coordinates for d1x71c1.
(The format of our PDB-style files is described here.)

Timeline for d1x71c1: