| Class b: All beta proteins [48724] (165 folds) |
| Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (8 families) ![]() bind hydrophobic ligands in their interior |
| Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins) barrel, closed; n=8, S=12, meander |
| Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries) |
| Domain d1x71c1: 1x71 C:4-177 [121770] automatically matched to d1l6ma_ complexed with db1, fe; mutant |
PDB Entry: 1x71 (more details), 2.1 Å
SCOP Domain Sequences for d1x71c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x71c1 b.60.1.1 (C:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid
Timeline for d1x71c1: