SCOP 1.73: Domain d1x71c1: 1x71 C:4-177

Lineage for d1x71c1 (1x71 C:4-177)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (8 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (7 PDB entries)

8. Domain d1x71c1: 1x71 C:4-177 [121770]
   automatically matched to d1l6ma_
   complexed with db1, fe; mutant

Details for d1x71c1

PDB Entry: 1x71, 2.1 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with trencam-3,2-hopo, a cepabactin analogue

PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOP Domain Sequences for d1x71c1:

Sequence; same for both SEQRES and ATOM records:

>d1x71c1 b.60.1.1 (C:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1x71c1:

• d1x71c1 is new in SCOP 1.73
  
• d1x71c1 appears in SCOP 1.75
  
• d1x71c1 appears in the current release, SCOPe 2.08, called d1x71c_