Lineage for d1x71c_ (1x71 C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2395398Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2395571Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 2395572Species Human (Homo sapiens) [TaxId:9606] [50836] (44 PDB entries)
  8. 2395617Domain d1x71c_: 1x71 C: [121770]
    automated match to d1ngla_
    complexed with db1, fe

Details for d1x71c_

PDB Entry: 1x71 (more details), 2.1 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with trencam-3,2-hopo, a cepabactin analogue
PDB Compounds: (C:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d1x71c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x71c_ b.60.1.1 (C:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

SCOPe Domain Coordinates for d1x71c_:

Click to download the PDB-style file with coordinates for d1x71c_.
(The format of our PDB-style files is described here.)

Timeline for d1x71c_: