SCOPe 2.05: Domain d1x71a_: 1x71 A:

Lineage for d1x71a_ (1x71 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (34 PDB entries)

8. Domain d1x71a_: 1x71 A: [121768]
   automated match to d1ngla_
   complexed with db1, fe

Details for d1x71a_

PDB Entry: 1x71, 2.1 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with trencam-3,2-hopo, a cepabactin analogue

PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d1x71a_:

Sequence; same for both SEQRES and ATOM records:

>d1x71a_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
stsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedk
synvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvf
fkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Timeline for d1x71a_:

• d1x71a_ first appeared in SCOP 1.73, called d1x71a1
  
• d1x71a_ appears in SCOPe 2.04
  
• d1x71a_ appears in SCOPe 2.06
  
• d1x71a_ appears in the current release, SCOPe 2.08