![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins) N-terminal domain is a 8-bladed beta-propeller |
![]() | Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries) |
![]() | Domain d1x70a2: 1x70 A:509-766 [121765] Other proteins in same PDB: d1x70a1, d1x70b1 automatically matched to d1orva2 complexed with 715, na, nag |
PDB Entry: 1x70 (more details), 2.1 Å
SCOPe Domain Sequences for d1x70a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x70a2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah qhiythmshfikqcfslp
Timeline for d1x70a2: