Lineage for d1x70a2 (1x70 A:509-766)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1002544Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1002545Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1003635Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
  6. 1003642Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 1003717Species Pig (Sus scrofa) [TaxId:9823] [89771] (28 PDB entries)
  8. 1003728Domain d1x70a2: 1x70 A:509-766 [121765]
    Other proteins in same PDB: d1x70a1, d1x70b1
    automatically matched to d1orva2
    complexed with 715, na, nag

Details for d1x70a2

PDB Entry: 1x70 (more details), 2.1 Å

PDB Description: human dipeptidyl peptidase iv in complex with a beta amino acid inhibitor
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1x70a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x70a2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d1x70a2:

Click to download the PDB-style file with coordinates for d1x70a2.
(The format of our PDB-style files is described here.)

Timeline for d1x70a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x70a1