Lineage for d1x70a1 (1x70 A:39-508)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960620Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 960709Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 960710Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 960717Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 960792Species Pig (Sus scrofa) [TaxId:9823] [89381] (28 PDB entries)
  8. 960803Domain d1x70a1: 1x70 A:39-508 [121764]
    Other proteins in same PDB: d1x70a2, d1x70b2
    automatically matched to d1orva1
    complexed with 715, na, nag

Details for d1x70a1

PDB Entry: 1x70 (more details), 2.1 Å

PDB Description: human dipeptidyl peptidase iv in complex with a beta amino acid inhibitor
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1x70a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x70a1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d1x70a1:

Click to download the PDB-style file with coordinates for d1x70a1.
(The format of our PDB-style files is described here.)

Timeline for d1x70a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x70a2