SCOP 1.73: Domain d1x70a1: 1x70 A:39-508

Lineage for d1x70a1 (1x70 A:39-508)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
   consists of eight 4-stranded beta-sheet motifs; meander
   also found in some members of the WD40-repeat superfamily

4. Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family)

5. Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
   Pfam PF00930

6. Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89381] (28 PDB entries)

8. Domain d1x70a1: 1x70 A:39-508 [121764]
   Other proteins in same PDB: d1x70a2, d1x70b2
   automatically matched to d1orva1
   complexed with 715, na, nag, ndg; mutant

Details for d1x70a1

PDB Entry: 1x70, 2.1 Å

PDB Description: human dipeptidyl peptidase iv in complex with a beta amino acid inhibitor

PDB Compounds: (A:) dipeptidyl peptidase IV

SCOP Domain Sequences for d1x70a1:

Sequence; same for both SEQRES and ATOM records:

>d1x70a1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
trktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

Timeline for d1x70a1:

• d1x70a1 is new in SCOP 1.73
  
• d1x70a1 appears in SCOP 1.75
  
• d1x70a1 appears in the current release, SCOPe 2.08