Lineage for d1x6za2 (1x6z A:29-144)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185566Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2185567Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2185568Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 2185589Protein automated matches [190127] (3 species)
    not a true protein
  7. 2185592Species Pseudomonas aeruginosa [TaxId:287] [186851] (6 PDB entries)
  8. 2185593Domain d1x6za2: 1x6z A:29-144 [121763]
    Other proteins in same PDB: d1x6za3
    automated match to d1dzoa_

Details for d1x6za2

PDB Entry: 1x6z (more details), 0.78 Å

PDB Description: Structure 1: cryocooled crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 0.78A resolution
PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d1x6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6za2 d.24.1.1 (A:29-144) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgtialk
pdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOPe Domain Coordinates for d1x6za2:

Click to download the PDB-style file with coordinates for d1x6za2.
(The format of our PDB-style files is described here.)

Timeline for d1x6za2:

Domains from same chain:
(mouse over for more information)
d1x6za3