Lineage for d1x6za1 (1x6z A:25-144)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857413Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 857414Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 857415Family d.24.1.1: Pilin [54524] (4 proteins)
  6. 857427Protein Type IV Pilin Pak [109620] (1 species)
  7. 857428Species Pseudomonas aeruginosa [TaxId:287] [54527] (8 PDB entries)
  8. 857429Domain d1x6za1: 1x6z A:25-144 [121763]
    automatically matched to d1dzoa_

Details for d1x6za1

PDB Entry: 1x6z (more details), 0.78 Å

PDB Description: Structure 1: cryocooled crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 0.78A resolution
PDB Compounds: (A:) fimbrial protein

SCOP Domain Sequences for d1x6za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6za1 d.24.1.1 (A:25-144) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOP Domain Coordinates for d1x6za1:

Click to download the PDB-style file with coordinates for d1x6za1.
(The format of our PDB-style files is described here.)

Timeline for d1x6za1: