![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
![]() | Superfamily d.24.1: Pili subunits [54523] (7 families) ![]() bacterial filament proteins |
![]() | Family d.24.1.1: Pilin [54524] (4 proteins) |
![]() | Protein Type IV Pilin Pak [109620] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [54527] (8 PDB entries) |
![]() | Domain d1x6za1: 1x6z A:25-144 [121763] automatically matched to d1dzoa_ |
PDB Entry: 1x6z (more details), 0.78 Å
SCOP Domain Sequences for d1x6za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6za1 d.24.1.1 (A:25-144) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]} gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr
Timeline for d1x6za1: