Lineage for d1x6za2 (1x6z A:29-144)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2509472Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2509473Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2509474Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 2509495Protein automated matches [190127] (3 species)
    not a true protein
  7. 2509498Species Pseudomonas aeruginosa [TaxId:287] [186851] (6 PDB entries)
  8. 2509499Domain d1x6za2: 1x6z A:29-144 [121763]
    Other proteins in same PDB: d1x6za3
    automated match to d1dzoa_

Details for d1x6za2

PDB Entry: 1x6z (more details), 0.78 Å

PDB Description: Structure 1: cryocooled crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 0.78A resolution
PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d1x6za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6za2 d.24.1.1 (A:29-144) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgtialk
pdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOPe Domain Coordinates for d1x6za2:

Click to download the PDB-style file with coordinates for d1x6za2.
(The format of our PDB-style files is described here.)

Timeline for d1x6za2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x6za3