Lineage for d1x6xx_ (1x6x X:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899788Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1899789Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 1899790Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 1899811Protein automated matches [190127] (3 species)
    not a true protein
  7. 1899814Species Pseudomonas aeruginosa [TaxId:287] [186851] (6 PDB entries)
  8. 1899816Domain d1x6xx_: 1x6x X: [121761]
    automated match to d1dzoa_

Details for d1x6xx_

PDB Entry: 1x6x (more details), 0.96 Å

PDB Description: structure 2: cryocolled crystal structure of the truncated pak pilin from pseudomonas aeruginosa at 0.95a resolution
PDB Compounds: (X:) fimbrial protein

SCOPe Domain Sequences for d1x6xx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6xx_ d.24.1.1 (X:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOPe Domain Coordinates for d1x6xx_:

Click to download the PDB-style file with coordinates for d1x6xx_.
(The format of our PDB-style files is described here.)

Timeline for d1x6xx_: