Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (4 families) bacterial filament proteins |
Family d.24.1.1: Pilin [54524] (4 proteins) |
Protein Type IV Pilin Pak [109620] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [54527] (8 PDB entries) |
Domain d1x6xx1: 1x6x X:25-144 [121761] automatically matched to d1dzoa_ |
PDB Entry: 1x6x (more details), 0.96 Å
SCOP Domain Sequences for d1x6xx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6xx1 d.24.1.1 (X:25-144) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]} gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr
Timeline for d1x6xx1: