SCOP 1.73: Domain d1x6xx1: 1x6x X:25-144

Lineage for d1x6xx1 (1x6x X:25-144)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (4 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (4 proteins)

6. Protein Type IV Pilin Pak [109620] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54527] (8 PDB entries)

8. Domain d1x6xx1: 1x6x X:25-144 [121761]
   automatically matched to d1dzoa_

Details for d1x6xx1

PDB Entry: 1x6x, 0.96 Å

PDB Description: structure 2: cryocolled crystal structure of the truncated pak pilin from pseudomonas aeruginosa at 0.95a resolution

PDB Compounds: (X:) fimbrial protein

SCOP Domain Sequences for d1x6xx1:

Sequence; same for both SEQRES and ATOM records:

>d1x6xx1 d.24.1.1 (X:25-144) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

Timeline for d1x6xx1:

• d1x6xx1 is new in SCOP 1.73
  
• d1x6xx1 appears in SCOP 1.75
  
• d1x6xx1 appears in the current release, SCOPe 2.08, called d1x6xx2