Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) bacterial filament proteins |
Family d.24.1.1: Pilin [54524] (5 proteins) |
Protein automated matches [190127] (3 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [186851] (6 PDB entries) |
Domain d1x6xx2: 1x6x X:29-144 [121761] Other proteins in same PDB: d1x6xx3 automated match to d1dzoa_ |
PDB Entry: 1x6x (more details), 0.96 Å
SCOPe Domain Sequences for d1x6xx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6xx2 d.24.1.1 (X:29-144) automated matches {Pseudomonas aeruginosa [TaxId: 287]} arsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgtialk pdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr
Timeline for d1x6xx2: