Lineage for d1x6vb2 (1x6v B:390-623)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693685Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (1 protein)
  6. 693686Protein ATP sulfurylase catalytic domain [63980] (5 species)
  7. 693709Species Human (Homo sapiens) [TaxId:9606] [142082] (3 PDB entries)
  8. 693711Domain d1x6vb2: 1x6v B:390-623 [121759]
    Other proteins in same PDB: d1x6va1, d1x6va3, d1x6vb1, d1x6vb3
    automatically matched to 1X6V A:390-624
    complexed with adp, cl

Details for d1x6vb2

PDB Entry: 1x6v (more details), 1.75 Å

PDB Description: the crystal structure of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1
PDB Compounds: (B:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1

SCOP Domain Sequences for d1x6vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6vb2 c.26.1.5 (B:390-623) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ndgldqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvl
llhplggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcra
rmvaganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkk
krmdyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyykslek

SCOP Domain Coordinates for d1x6vb2:

Click to download the PDB-style file with coordinates for d1x6vb2.
(The format of our PDB-style files is described here.)

Timeline for d1x6vb2: