Lineage for d1x6va3 (1x6v A:34-228)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 695492Family c.37.1.4: Adenosine-5'phosphosulfate kinase (APS kinase) [52572] (1 protein)
  6. 695493Protein Adenosine-5'phosphosulfate kinase (APS kinase) [52573] (2 species)
  7. 695505Species Human (Homo sapiens) [TaxId:9606] [142215] (3 PDB entries)
  8. 695506Domain d1x6va3: 1x6v A:34-228 [121757]
    Other proteins in same PDB: d1x6va1, d1x6va2, d1x6vb1, d1x6vb2
    complexed with adp, cl

Details for d1x6va3

PDB Entry: 1x6v (more details), 1.75 Å

PDB Description: the crystal structure of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1

SCOP Domain Sequences for d1x6va3:

Sequence, based on SEQRES records: (download)

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaplhvceqrdvkglykkarageikgftgidseyekpeapelvlktdscdvndcv
qqvvellqerdivpv

Sequence, based on observed residues (ATOM records): (download)

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}
hvsrnkrgqvvgtrggfrgctvwltglsgagkttvsmaleeylvchgipcytldgdnirq
glnknlgfspedreenvrriaevaklfadaglvcitsfispytqdrnnarqihegaslpf
fevfvdaeyekpeapelvlktdscdvndcvqqvvellqerdivpv

SCOP Domain Coordinates for d1x6va3:

Click to download the PDB-style file with coordinates for d1x6va3.
(The format of our PDB-style files is described here.)

Timeline for d1x6va3: