SCOP 1.73: Domain d1x6va2: 1x6v A:390-624

Lineage for d1x6va2 (1x6v A:390-624)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (1 protein)

6. Protein ATP sulfurylase catalytic domain [63980] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142082] (3 PDB entries)

8. Domain d1x6va2: 1x6v A:390-624 [121756]
   Other proteins in same PDB: d1x6va1, d1x6va3, d1x6vb1, d1x6vb3
   complexed with adp, cl

Details for d1x6va2

PDB Entry: 1x6v, 1.75 Å

PDB Description: the crystal structure of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1

PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1

SCOP Domain Sequences for d1x6va2:

Sequence; same for both SEQRES and ATOM records:

>d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
ndgldqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvl
llhplggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcra
rmvaganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkk
krmdyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksleka

Timeline for d1x6va2:

• d1x6va2 is new in SCOP 1.73
  
• d1x6va2 appears in SCOP 1.75
  
• d1x6va2 appears in the current release, SCOPe 2.08