![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.5: ATP sulfurylase catalytic domain [63979] (2 proteins) automatically mapped to Pfam PF01747 |
![]() | Protein ATP sulfurylase catalytic domain [63980] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142082] (3 PDB entries) Uniprot O43252 390-624 |
![]() | Domain d1x6va2: 1x6v A:390-624 [121756] Other proteins in same PDB: d1x6va1, d1x6va3, d1x6va4, d1x6vb1, d1x6vb3 complexed with adp, cl |
PDB Entry: 1x6v (more details), 1.75 Å
SCOPe Domain Sequences for d1x6va2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} ndgldqyrltptelkqkfkdmnadavsafqlrnpvhnghallmqdthkqllergyrrpvl llhplggwtkdddvplmwrmkqhaavleegvlnpettvvaifpspmmyagptevqwhcra rmvaganfyivgrdpagmphpetgkdlyepshgakvltmapglitleivpfrvaaynkkk krmdyydsehhedfefisgtrmrklaregqkppegfmapkawtvlteyyksleka
Timeline for d1x6va2: