Lineage for d1x6va1 (1x6v A:229-389)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 680324Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 680325Superfamily b.122.1: PUA domain-like [88697] (10 families) (S)
  5. 680390Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
  6. 680391Protein ATP sulfurylase N-terminal domain [63802] (5 species)
  7. 680414Species Human (Homo sapiens) [TaxId:9606] [141702] (3 PDB entries)
  8. 680415Domain d1x6va1: 1x6v A:229-389 [121755]
    Other proteins in same PDB: d1x6va2, d1x6va3, d1x6vb2, d1x6vb3
    complexed with adp, cl

Details for d1x6va1

PDB Entry: 1x6v (more details), 1.75 Å

PDB Description: the crystal structure of human 3'-phosphoadenosine-5'-phosphosulfate synthetase 1
PDB Compounds: (A:) Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthethase 1

SCOP Domain Sequences for d1x6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6va1 b.122.1.3 (A:229-389) ATP sulfurylase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dasyevkelyvpenklhlaktdaetlpalkinkvdmqwvqvlaegwatplngfmrereyl
qclhfdclldggvinlsvpivltathedkerldgctafalmyegrrvailrnpeffehrk
eercarqwgttcknhpyikmvmeqgdwliggdlqvldrvyw

SCOP Domain Coordinates for d1x6va1:

Click to download the PDB-style file with coordinates for d1x6va1.
(The format of our PDB-style files is described here.)

Timeline for d1x6va1: