SCOPe 2.02: Domain d1x6ra_: 1x6r A:

Lineage for d1x6ra_ (1x6r A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (7 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (5 proteins)

6. Protein automated matches [190127] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186851] (6 PDB entries)

8. Domain d1x6ra_: 1x6r A: [121753]
   automated match to d1dzoa_

Details for d1x6ra_

PDB Entry: 1x6r, 1.82 Å

PDB Description: Structure 5: room temperature crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 1.80A resolution

PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d1x6ra_:

Sequence; same for both SEQRES and ATOM records:

>d1x6ra_ d.24.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

Timeline for d1x6ra_:

• d1x6ra_ first appeared in SCOP 1.73, called d1x6ra1
  
• d1x6ra_ appears in SCOPe 2.01
  
• d1x6ra_ appears in SCOPe 2.03
  
• d1x6ra_ appears in the current release, SCOPe 2.08, called d1x6ra2