Lineage for d1x6ra_ (1x6r A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022488Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1022489Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 1022490Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 1022511Protein automated matches [190127] (3 species)
    not a true protein
  7. 1022514Species Pseudomonas aeruginosa [TaxId:287] [186851] (6 PDB entries)
  8. 1022520Domain d1x6ra_: 1x6r A: [121753]
    automated match to d1dzoa_

Details for d1x6ra_

PDB Entry: 1x6r (more details), 1.82 Å

PDB Description: Structure 5: room temperature crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 1.80A resolution
PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d1x6ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6ra_ d.24.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
gtefarsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgt
ialkpdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

SCOPe Domain Coordinates for d1x6ra_:

Click to download the PDB-style file with coordinates for d1x6ra_.
(The format of our PDB-style files is described here.)

Timeline for d1x6ra_: