SCOPe 2.06: Domain d1x6qa2: 1x6q A:29-144

Lineage for d1x6qa2 (1x6q A:29-144)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (5 proteins)

6. Protein automated matches [190127] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186851] (6 PDB entries)

8. Domain d1x6qa2: 1x6q A:29-144 [121752]
   Other proteins in same PDB: d1x6qa3
   automated match to d1dzoa_

Details for d1x6qa2

PDB Entry: 1x6q, 1.51 Å

PDB Description: Structure 3: cryocooled crystal structure of the truncated pak pilin from Pseudomonas aeruginosa at 1.51A resolution

PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d1x6qa2:

Sequence; same for both SEQRES and ATOM records:

>d1x6qa2 d.24.1.1 (A:29-144) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
arsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgtialk
pdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

Timeline for d1x6qa2:

• d1x6qa2 first appeared in SCOP 1.73, called d1x6qa1
  
• d1x6qa2 was called d1x6qa_ in SCOPe 2.05
  
• d1x6qa2 appears in SCOPe 2.07
  
• d1x6qa2 appears in the current release, SCOPe 2.08