Lineage for d1x6na1 (1x6n A:24-132)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765224Protein Chitinase A, N-terminal domain N [49233] (1 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 2765225Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries)
    Uniprot P07254 24-563
  8. 2765235Domain d1x6na1: 1x6n A:24-132 [121748]
    Other proteins in same PDB: d1x6na2, d1x6na3
    automated match to d1rd6a1
    complexed with ao3; mutant

Details for d1x6na1

PDB Entry: 1x6n (more details), 2 Å

PDB Description: crystal structure of s. marcescens chitinase a mutant w167a in complex with allosamidin
PDB Compounds: (A:) chitinase a

SCOPe Domain Sequences for d1x6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6na1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdagttakillng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOPe Domain Coordinates for d1x6na1:

Click to download the PDB-style file with coordinates for d1x6na1.
(The format of our PDB-style files is described here.)

Timeline for d1x6na1: