Lineage for d1x6la3 (1x6l A:444-516)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720646Protein Chitinase A [54558] (1 species)
  7. 720647Species Serratia marcescens [TaxId:615] [54559] (11 PDB entries)
  8. 720654Domain d1x6la3: 1x6l A:444-516 [121747]
    Other proteins in same PDB: d1x6la1, d1x6la2
    automatically matched to d1ctn_3
    mutant

Details for d1x6la3

PDB Entry: 1x6l (more details), 1.9 Å

PDB Description: crystal structure of s. marcescens chitinase a mutant w167a
PDB Compounds: (A:) chitinase a

SCOP Domain Sequences for d1x6la3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6la3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
vfkpstgdlitfd

SCOP Domain Coordinates for d1x6la3:

Click to download the PDB-style file with coordinates for d1x6la3.
(The format of our PDB-style files is described here.)

Timeline for d1x6la3: