Lineage for d1x6la2 (1x6l A:133-443,A:517-561)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 683248Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 683281Protein Chitinase A, catalytic domain [51544] (1 species)
  7. 683282Species Serratia marcescens [TaxId:615] [51545] (11 PDB entries)
  8. 683289Domain d1x6la2: 1x6l A:133-443,A:517-561 [121746]
    Other proteins in same PDB: d1x6la1, d1x6la3
    automatically matched to d1ctn_2
    mutant

Details for d1x6la2

PDB Entry: 1x6l (more details), 1.9 Å

PDB Description: crystal structure of s. marcescens chitinase a mutant w167a
PDB Compounds: (A:) chitinase a

SCOP Domain Sequences for d1x6la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6la2 c.1.8.5 (A:133-443,A:517-561) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]}
tdgshlpplkeslleknkpykqnsgkvvgsyfveagvygrnftvdkipaqnlthllygfi
picggngindslkeiegsfqalqrscqgredfkisihdpfaalqkaqkgvtawddpykgn
fgqlmalkqahpdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdi
dwefpggkganpnlgspqdgetyvllmkelramldqlsaetgrkyeltsaisagkdkidk
vaynvaqnsmdhiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgv
kpgkivvgtamXdarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsag

SCOP Domain Coordinates for d1x6la2:

Click to download the PDB-style file with coordinates for d1x6la2.
(The format of our PDB-style files is described here.)

Timeline for d1x6la2: