Lineage for d1x6la1 (1x6l A:24-132)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658705Protein Chitinase A, N-terminal domain N [49233] (1 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 658706Species Serratia marcescens [TaxId:615] [49234] (11 PDB entries)
  8. 658713Domain d1x6la1: 1x6l A:24-132 [121745]
    Other proteins in same PDB: d1x6la2, d1x6la3
    automatically matched to d1ctn_1
    mutant

Details for d1x6la1

PDB Entry: 1x6l (more details), 1.9 Å

PDB Description: Crystal structure of S. marcescens chitinase A mutant W167A
PDB Compounds: (A:) chitinase a

SCOP Domain Sequences for d1x6la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6la1 b.1.18.2 (A:24-132) Chitinase A, N-terminal domain N {Serratia marcescens [TaxId: 615]}
aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdagttakillng
keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvad

SCOP Domain Coordinates for d1x6la1:

Click to download the PDB-style file with coordinates for d1x6la1.
(The format of our PDB-style files is described here.)

Timeline for d1x6la1: