![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
![]() | Protein Zinc finger protein 24 [144143] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [144144] (1 PDB entry) Uniprot P17028 272-304! Uniprot P17028 305-330 |
![]() | Domain d1x6ea1: 1x6e A:8-40 [121740] Other proteins in same PDB: d1x6ea3, d1x6ea4 complexed with zn |
PDB Entry: 1x6e (more details)
SCOPe Domain Sequences for d1x6ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} ihsgekpygcvecgkafsrssilvqhqrvhtge
Timeline for d1x6ea1: