Lineage for d1x6ea1 (1x6e A:8-40)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035157Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 3035158Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 3035159Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 3035341Protein Zinc finger protein 24 [144143] (1 species)
  7. 3035342Species Human (Homo sapiens) [TaxId:9606] [144144] (1 PDB entry)
    Uniprot P17028 272-304! Uniprot P17028 305-330
  8. 3035343Domain d1x6ea1: 1x6e A:8-40 [121740]
    Other proteins in same PDB: d1x6ea3, d1x6ea4
    complexed with zn

Details for d1x6ea1

PDB Entry: 1x6e (more details)

PDB Description: solution structures of the c2h2 type zinc finger domain of human zinc finger protein 24
PDB Compounds: (A:) Zinc finger protein 24

SCOPe Domain Sequences for d1x6ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]}
ihsgekpygcvecgkafsrssilvqhqrvhtge

SCOPe Domain Coordinates for d1x6ea1:

Click to download the PDB-style file with coordinates for d1x6ea1.
(The format of our PDB-style files is described here.)

Timeline for d1x6ea1: