Lineage for d1x6da1 (1x6d A:8-114)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 797796Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 797797Superfamily b.36.1: PDZ domain-like [50156] (6 families) (S)
    peptide-binding domain
  5. 798055Family b.36.1.2: Interleukin 16 [50172] (1 protein)
  6. 798056Protein Interleukin 16 [50173] (1 species)
  7. 798057Species Human (Homo sapiens) [TaxId:9606] [50174] (2 PDB entries)
  8. 798058Domain d1x6da1: 1x6d A:8-114 [121739]
    1st PDZ domain

Details for d1x6da1

PDB Entry: 1x6d (more details)

PDB Description: solution structures of the pdz domain of human interleukin-16
PDB Compounds: (A:) Interleukin-16

SCOP Domain Sequences for d1x6da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]}
atlkqldgihvtilhkeegaglgfslaggadlenkvitvhrvfpnglasqegtiqkgnev
lsingkslkgtthhdalailrqareprqavivtrkltpeampdlnss

SCOP Domain Coordinates for d1x6da1:

Click to download the PDB-style file with coordinates for d1x6da1.
(The format of our PDB-style files is described here.)

Timeline for d1x6da1: