Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Lim domain kinase 2 [144183] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144184] (1 PDB entry) Uniprot P53671 62-95! Uniprot P53671 96-129 |
Domain d1x6aa1: 1x6a A:8-41 [121737] Other proteins in same PDB: d1x6aa3, d1x6aa4 complexed with zn |
PDB Entry: 1x6a (more details)
SCOPe Domain Sequences for d1x6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} kdywgkfgefchgcsllmtgpfmvagefkyhpec
Timeline for d1x6aa1: