SCOP 1.75: Domain d1x68a2: 1x68 A:37-70

Lineage for d1x68a2 (1x68 A:37-70)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Four and a half LIM domains protein 5, FHL-5 [144181] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144182] (1 PDB entry)
   Uniprot Q5TD97 222-250! Uniprot Q5TD97 251-284

8. Domain d1x68a2: 1x68 A:37-70 [121736]
   complexed with zn

Details for d1x68a2

PDB Entry: 1x68

PDB Description: solution structures of the c-terminal lim domain of human fhl5 protein

PDB Compounds: (A:) FHL5 protein

SCOP Domain Sequences for d1x68a2:

Sequence; same for both SEQRES and ATOM records:

>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]}
ncgkcsvslvgkgfltqnkeifcqkcgsgmdtdi

Timeline for d1x68a2:

• d1x68a2 first appeared in SCOP 1.73
  
• d1x68a2 appears in SCOPe 2.01
  
• d1x68a2 appears in the current release, SCOPe 2.08