Lineage for d1x68a2 (1x68 A:37-70)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2586757Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2586758Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2586896Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2586957Protein Four and a half LIM domains protein 5, FHL-5 [144181] (1 species)
  7. 2586958Species Human (Homo sapiens) [TaxId:9606] [144182] (1 PDB entry)
    Uniprot Q5TD97 222-250! Uniprot Q5TD97 251-284
  8. 2586960Domain d1x68a2: 1x68 A:37-70 [121736]
    Other proteins in same PDB: d1x68a3, d1x68a4
    complexed with zn

Details for d1x68a2

PDB Entry: 1x68 (more details)

PDB Description: Solution structures of the C-terminal LIM domain of human FHL5 protein
PDB Compounds: (A:) FHL5 protein

SCOPe Domain Sequences for d1x68a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]}
ncgkcsvslvgkgfltqnkeifcqkcgsgmdtdi

SCOPe Domain Coordinates for d1x68a2:

Click to download the PDB-style file with coordinates for d1x68a2.
(The format of our PDB-style files is described here.)

Timeline for d1x68a2: