Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Four and a half LIM domains protein 1, FHL-1 [144163] (1 species) Skeletal muscle lim-protein 1 |
Species Human (Homo sapiens) [TaxId:9606] [144164] (3 PDB entries) Uniprot Q13642 128-159! Uniprot Q13642 161-185! Uniprot Q13642 186-216! Uniprot Q13642 39-66! Uniprot Q13642 67-97! Uniprot Q13642 90-127! Uniprot Q13642 98-127 |
Domain d1x63a1: 1x63 A:8-44 [121731] Other proteins in same PDB: d1x63a3, d1x63a4 complexed with zn |
PDB Entry: 1x63 (more details)
SCOPe Domain Sequences for d1x63a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} kcttredspkckgcfkaivagdqnveykgtvwhkdcf
Timeline for d1x63a1: