SCOP 1.73: Domain d1x63a1: 1x63 A:8-44

Lineage for d1x63a1 (1x63 A:8-44)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Four and a half LIM domains protein 1, FHL-1 [144163] (1 species)
   Skeletal muscle lim-protein 1

7. Species Human (Homo sapiens) [TaxId:9606] [144164] (3 PDB entries)

8. Domain d1x63a1: 1x63 A:8-44 [121731]
   complexed with zn

Details for d1x63a1

PDB Entry: 1x63

PDB Description: solution structure of the second lim domain of skeletal muscle lim protein 1

PDB Compounds: (A:) Skeletal muscle LIM-protein 1

SCOP Domain Sequences for d1x63a1:

Sequence; same for both SEQRES and ATOM records:

>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]}
kcttredspkckgcfkaivagdqnveykgtvwhkdcf

Timeline for d1x63a1:

• d1x63a1 is new in SCOP 1.73
  
• d1x63a1 appears in SCOP 1.75
  
• d1x63a1 appears in the current release, SCOPe 2.08