Lineage for d1x62a2 (1x62 A:8-42)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892407Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 892408Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families) (S)
  5. 892525Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 892610Protein PDZ and LIM domain protein 1 Elfin [144171] (1 species)
    C-terminal LIM domain protein 1
  7. 892611Species Human (Homo sapiens) [TaxId:9606] [144172] (1 PDB entry)
    Uniprot O00151 249-279! Uniprot O00151 280-314
  8. 892613Domain d1x62a2: 1x62 A:8-42 [121730]
    complexed with zn

Details for d1x62a2

PDB Entry: 1x62 (more details)

PDB Description: solution structure of the lim domain of carboxyl terminal lim domain protein 1
PDB Compounds: (A:) C-terminal LIM domain protein 1

SCOP Domain Sequences for d1x62a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]}
signaqklpmcdkcgtgivgvfvklrdrhrhpecy

SCOP Domain Coordinates for d1x62a2:

Click to download the PDB-style file with coordinates for d1x62a2.
(The format of our PDB-style files is described here.)

Timeline for d1x62a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1x62a1