SCOP 1.73: Domain d1x62a1: 1x62 A:43-73

Lineage for d1x62a1 (1x62 A:43-73)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein PDZ and LIM domain protein 1 Elfin [144171] (1 species)
   C-terminal LIM domain protein 1

7. Species Human (Homo sapiens) [TaxId:9606] [144172] (1 PDB entry)

8. Domain d1x62a1: 1x62 A:43-73 [121729]
   complexed with zn

Details for d1x62a1

PDB Entry: 1x62

PDB Description: solution structure of the lim domain of carboxyl terminal lim domain protein 1

PDB Compounds: (A:) C-terminal LIM domain protein 1

SCOP Domain Sequences for d1x62a1:

Sequence; same for both SEQRES and ATOM records:

>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]}
vctdcgtnlkqkghffvedqiycekharerv

Timeline for d1x62a1:

• d1x62a1 is new in SCOP 1.73
  
• d1x62a1 appears in SCOP 1.75
  
• d1x62a1 appears in the current release, SCOPe 2.08