| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
| Protein Receptor-type tyrosine-protein phosphatase delta, PTPRD [141049] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141050] (2 PDB entries) Uniprot P23468 504-607 |
| Domain d1x5za1: 1x5z A:8-109 [121726] Other proteins in same PDB: d1x5za2, d1x5za3 |
PDB Entry: 1x5z (more details)
SCOPe Domain Sequences for d1x5za1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}
diqvitqtgvpgqplnfkaepesetsillswtpprsdtianyelvykdgehgeeqritie
pgtsyrlqglkpnslyyfrlaarspqglgastaeisartmqs
Timeline for d1x5za1: