Lineage for d1x5ya1 (1x5y A:8-105)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2372065Protein Myosin binding protein C, fast-type [141057] (1 species)
  7. 2372066Species Mouse (Mus musculus) [TaxId:10090] [141058] (1 PDB entry)
    Uniprot Q5XKE0 731-828
  8. 2372067Domain d1x5ya1: 1x5y A:8-105 [121725]
    Other proteins in same PDB: d1x5ya2, d1x5ya3

Details for d1x5ya1

PDB Entry: 1x5y (more details)

PDB Description: solution structure of the fibronectin type-iii domain of mouse myosin- binding protein c, fast-type homolog
PDB Compounds: (A:) myosin binding protein C, fast-type

SCOPe Domain Sequences for d1x5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]}
ptsapqhltvedvtdttttlkwrppdrigaggidgylveyclegseewvpankepvercg
ftvkdlptgarilfrvvgvniagrsepatllqpvtire

SCOPe Domain Coordinates for d1x5ya1:

Click to download the PDB-style file with coordinates for d1x5ya1.
(The format of our PDB-style files is described here.)

Timeline for d1x5ya1: